*IsWdbtldE@/BTSYCøЏ   xЏ x~ l` 8Џ 8n ,y v HO N YV 0Os t= hH Of @0 4; OYl # .    ̟    0  0Ȍ6kp Q Ȍ\kpl<>  d  +Q+Q:Qq0S*Q Qt*Ap (*, * * *00   0 ) )  0\ 4   @|@LHTDpqF`mP Df 8c*,`D hQ`00o`Z2S`c00^`IGS ןh:xl (   2 0 ,P PPXPWAKEv`^ & & & &     th  h \         U  1          J  U  3   P $  $ $ $ $ $  1 @x40D xD@@!00000000D4 <4$D@@T4 P40!@P`p3Q pP 3 30# #  !`p4Q pP/   0@### @0## # ####  Q00P   1000/    P/**/>?  @0123456789ABCDEFSTKP??@MTSTMBK2ENDMPRE$PST$PREZPSTZFLSHUNDFSWI PABTDABTIRQ FIQNUSDDRAM ERRORWKUPSKWUdedeTUTE 0040Q40pCCJJrCq EE`IIECECbtld4d@l@h@`@@BCR -L( $181@T  18&p0\80@ 0 9 Q000; >0@  01 Pp0t@t  01 PX04v8400 @00h<<@<D<H<L<  ?P< -L| @\*h0Pdpd` \, 01. 01ƌ\: 00 00L<  -L, *$0001#::TL< 0-L MⰠ P 707078@K87x0P7877E87<07407,07$07T<X<\<`<d<h<l<0 -L 0 p< -L\ @T 7@07807007T 70|7t<x<|<< -L4 'lHDHPX%XER 2e72b71_71\71Y71V7DV iV 91N7T/1I7U 1U !111<7T T d147\1U <U T1D1H1'7)U81"7 ,1e71`7 1[71U8S 0000060;70670606|06pp<<<x<<l<<< <<<<<<<<< <<<<<<<<<< -L4 000 00006 00<< 0-LT @H0P 0S 40  n00000X<< -LX T0P0 0R000(00 000<<< -LMl000 20`3c12c R*80`3c12c#00lS000 0S: p-L @`0,wn0P6 P P "P PP  P P~PT 0D@6 6600` 5 5 @,000S50@Vp<< -L `p \. 0P@0^0;\0S ^#^ ^"\  \ \@ "\0@1 \\ ^  \01V 0;S00= -LBMܠ P, XM0001 JKPB =dk@P7 k`@05505@a k00T055054l@P  @kP== =deP a00P a00$0kk,1X= p-LP`@Q ppGkP @2Sp 0-LMP @0S _K,pmK ">K/P20 B0S=0 -L 00 00000 00C400 00 000p0`@0P0S050S -0S `0jP D000S 4054<== =$=<(=,=0=4= p-L̠ 0@ Rp 05P00Up0`A@A@0@4p04h0 4\0$4P0$0 4<0(4P00Up8=<=l<@=D=H=L= -L$ P4 04P= -L  -L P @`P0w40t4|jpP0 jj + R00S R0^4@ u5@ p5P`0AjP0  d50} T*,0  CT=X=\=`=d=h= 0-L P@*4ll=p=0 -L∠ !30x04l00 ~rR 1 D00!~rRA(0J400 (t=x=|== 0-L ML P3@0448@KE4$03303t===0 -L,M\ < @ 20L0 @0L4@0D0 T D0S S q0==L h 210 0H0 1D3130P0 30`18pKAP~u 00l13`13P`V` 81 `VP$13`1p A1U3 T `V`08pK0A3030S00`VP00T R 03<0SD QH0P@  @ D00D0 S<00@  @ ===x===?===== -LM< KS,0r3$0 n30j3l=== -Lģ p`30 P3QP3S33O33@0`3G3 t3B3h3>3U T32{<30 30000#00C40U20S 232 2232 008<U 20X2 0 022@th22`2T20@L20 `~P8221000200S C1@00 410 10 0S 00Q 10A10 0S yC~A 1k2x1h2p1 00d10 P\10 @U/<1 810 00,!0S W0000 00]2 P P 00 W00R0S <0000 0)2=@<==<============>>> >>>>> >$>(>,>0>4>8> -LP  -L P 01000S001 1 R00 S  6 R00 S Rx0 00 3 R00S  2 R00S R$0 0001|<>@>D>H>L> -L0M @`p00 P0gPT 0 ,p0O P 2P000S |01 PT 2p@000S 40t1r1$0o1!\P>T>X>\>`>d>l<W 0@K II@0PY1W1P@K2Q1O1 0L1h>l< 0-L젟 000@09100T3110v10101010 |1t0x1h0t1 PX0o1L0$k1@0g10=l>p>t>x>|>>>>>>>> -L⠠ 00 @Pʌ00 2l000S`0\000< T00Q0#S8040 00 0>>\>>>>=> 0-L䠟 PP000 1@000S 00000 0S eKPh0 3E?6C#::01H00<00400@,00P0>\>>>=>l<>> -LM⨣  p Ph`K30 00 ,P  P L3@[0Y0',P$3! w  3 0  00'00Q 2@8060,P2.0 KP,0 S x2@h0e0b0L20!0 420  0S@ @1/\P11/@PUAh0K0 P ` X K@ 5,`@h`K 5h8#8 X1/S0D1/N041/?00S@U @X  P)@0P# @PiUʼ0/PD 00  Ni@0/x0p/p0TB `0&\0$T0">>>>>>>>>>>>>?l<?=? ???80/,0/ 0/0g/=?? ?$?0#P00 0`@T!1R@T 00 `00 P00 @|0@/ 0a@ b 0 D01/0   f=(?,?0?4?8? -LM☠ pP`0//t0 /l00 0S \0/ID0.@T $0.@?D?H?k/80-/ $0.  0]>L? 0-L P@P1..0.0.0(0 0..0.(0 0..0.(0 l0..d0.\0. u@0dP00000P?l<T?X?\?`?d?h?l?p? -LMؠ @PDP.`P4  /pP6  /@P0 0c.a.t0^.l0.`0.@(00 000=dP 0/t?l<x?|?l?p?(0:.8.05.02.?l<? 0-LĠ P0@PP0..0.00..p0.l0@h0R.\0 N.P0$J.0 $"P0(0-0L?l<?=???? -L4 00 ,00"P0-P==H? 0-L̠ @Pʼ0-0 .P000S0 .@p000S d0-\0-P0-D00j"P0(0-0?\>????=H? 0-Lؠ @P0-0 .P000S 0~-|-0  .@d000S \0m-T0-H0-&"P0(0]-0?\>?l<???H? 0-Ll @P\1H-0 `.P<100S01(1+cP@8 1$cP 0D/  i R00S  n R00S  t R00S R 0cP 0000#1x  A d0bP25@ @D0@-80<-0?\>???>?=??? p-Lⴡ PPʤ1,p -`100Sx1 -@X100SP1L1,D1-81-(1bP@p 1bP@D40p  i R00S  n R00S  t R00S R@p 0bP5@p x0zbP d00 P H0y,p@p4?\>????????>?? 0-L⠠ @0S P0LbPP o-@@U P0,D00@080,O0@ 0<,O04?@@@ @ 0-Lؠ @P0),01 @-P000S0 i R00S  d R00S R D0aP  0B,0h@\>?@@ -LⰡ @p10 Xʐ1+PP t1++d1+ `AL1 aP Y01+$1+  ,`000S 0++0+0+X ,p000S 0++`0+t0+VY`0 W  d>@ @l<$@(@,@\>0@4@8@<@@@ -L┡ @Pʄ1i+ ,pd100S T1[+Y+D1 p,` 100S 1J+H+1  _,P000S 09+ 7+0U00+ .+0 P 0k+0g+t0c+& TL0+D0 @0S+hD@\>0@l<8@H@L@P@T@X@\@=`@ -LM⨠ P@U0!p, 00=S.S -S h00P X0 00H0  +`(000S 0*?ꄻd@>\>h@l@U +U  +pU +, U +~h0*\0 *P0*D0,*80*Y* , 0p@t@x@|@@ 0-L☠ Pʌ0{*0 +l000S`0!*X000A$ZZDF<0*40*(0*0鬹@\>l@L<@@@ -Lܠ @ T" KT nT KTT K T T K T T0T T l0.*d0+*\0(*P0k*D00)40b*(00$@@@@@=@= -L -L -LQJ@ 0P@?: 00?@ -L( $00 0,*`(>@ -L(  00 0*,>@ -L` PT0@ *40 0S0000 0)ж=@ -L( $0 00S0)P0>@ -L 0 00= -L/ 0-LM∠ @P|0K aT *KT *KT  *K[[ [0[O:@0 0-L{@P  a0 -L -L -L⨠ P Y*P |00 p00 h00 `0 0 D00 800 000 (0 0000鴴$=0=<=@ -L 0 )@ -L 0(鴳@ -L 00P鈳@ -L 0 000P@ -L 0 0S0C0@ -L PY1( )p100S1 )`100S1  )@l100Sh1Y  )8100S8141(,1( 1(1(1(X X )X &@Dt 00@Dt@Dt 0 40C40@Dt@Dt 00@Dt<0(@\>@@@@@@@@@@ -L\M pQZ K  *):0|0K0C{0KzPK`W  )P PV 0-00`V  pW00@f@   C`PD0 e`P`X .P 0B_S0꘰@00`V  X00@v   `PPf 000C0 0C0K'W 0-LPP (@@ (0 -L̠ @00 0S 0000006-P ,0 8 Tl0 h00@c`0@\ 00T0L0H 000C080鸮><> @@  -L -L 0v'鐭A p-LX @P`D0 '80',0' 0'pdAA AA -LP @Y82F' ^(P200S 2 S(p100S1  H(`100S1Y  ;(100S11'1X't1T'h1P'\1L'X X >X+ ;@@P`Fv 0R yP @`Fv 0AA@@A A$A@@@ -L -Ll h0&W \0&T0 P0D0& "80&, ,0&4(A,A=0A4A8AAAHALAPATAXA\A,@0S 0%0%x0%l0%X(H00^PU40%X $0%|<`AdAhAXAlApA -Lh P\0%@P  &0000S 00ܥtA\>xA|A -LM PKc[H00 KKX> -LM PKL[00 KKX> p-LMd @PX00 `TڇK0[80 0 42KC42KTGK"[ꐤAAGK[KGK p p-LM⠠ @P`TGK [|00 KTڇKZT0002 T  &`,000S 0$ X>A\>AGKK  p -L0S)  0 S: -L┠ @PpaT  %ph000S X0$T  %`(000S 0̢\>@@ -L䠟 @P`Tp0$T  %000S0T  %`d000S\0T  %0000S,0 0A\>@@A -LⰠ P`@pU  h%p000S p0B$U  X%@@000S 402$0r$\>AAA -LM( p, 00 040 P80 @TZP@T,P0$e00 `@TPYZ` O\`@T00F `h0p)40S 0 S S =S080 40S 0 0 040 $A=A80S 0 040S 0=S 00`PiY@Y@@U: `0 S S 0 S S000 S S , Y0Y R -LM Pp@`Q% B.K 000eS*0 S S00X0#BK#H0|#0 S S0 S S WBK#0eS:Al< -L P}$  -L⸠ V0#S0#P0#M|0#Jl0#G\0#DL0|#A<0w#,,0r#AAAAAAAAA p-LMP @PD00 `TڇKY$0 #TGKYP>AX00 KGKK P@T 0 S ""@TX>p -L̠ @`0 pPP#p0"U`ʄ0"Ut0""d0""T0"L0#  ,0"8X>AAAAAAA -L @0R  0Ss Q0SECEC -L 0-L@P P P0SP00 -L @+T0 0Q 0", 0R 0 "(Q @0"00 0S S SL0 P ,00"dbtldAAA>BB 0-Lܡ P@10 0S 1000 0 Q*0Q10 0S% t1Q l1G"d1TC"@Qq D1;"417",13"@:QQ) 1*"1 0Q 0!"0"@@0Q 0"0"@:PQ 0"0"@000 80<0\0!0,><B BBB!BB B$BECEC(B&,B0B=>4B -L 000< p-LM `IT@100S 0q!0 4  KC40K0 4  KC40K 0#8S0 0 00t00 0S h0000 H0 0 0D0 P $0 0 0$0>!강8B@B<DBHB$0 0 00.!00 `>LB>p 0-L␠ 0@ P0b! 0S l0000X X0000L0000:E)4$0 00>PB<TBXB\B 0-LM℠ @|0000 Pl0 "PT000SH0  !@(000S 0 h>`B\>dBhBK80 !00!$0000  lBpB>0 -LMⴠ p KP``KK@P  XPd0S h0l @X0 L0 @0h  3Z@ 0 TtBxB|BBB -L⼠ `P0l Ap 1PT0b @`P`P`Pt46SX0R 0S`!0SP,0F $0C pBBXABl< -L 00Q逐= -LD @<000S(0  0 D>BB -L4 00P000 0܏B> 0-LD @P80P0$000 00鈏B> p-LL @P`<0Pp(000 0 p$B> -L4 00P000 0 鸎B> -L< @40~P 000 0dB> 0-LD @P80fP0$000 00B> p-LL @P`<0LPp(000 0 p餍B> 0-L@ <000@UP!@08? -LD Q,0 (0000܌BBB 0-L 000P@T T U Uh`UPPT T UU0t?U -L␠ 000@th`UP@8/0U, )&鐋?U -LUm -LU@pd -LUP[ -Lp@`1P@DTo`0S@ -LM< p0100@ $A a, 0S 10 00,:U@P`FV0SV45<0S l0]P0 T080,80 ?-1BBBBBBB -LM P!H6K;<$0 ` x P 0'0k0g,U@-$K\`R$0S \0 H0ND0J,0F(0BꌈBBBBBB 0-L@P!P0%0 -L 100P %Q?pBa@7PF@T@T @P@DTPPT45<0S D0<0 00?-1BBB -L M0 , @$100`` 0S040 T0 G 4 K$UP7 E @T 0 0@T x@@DT  pT 80F00,$0 ̅?-1BBB`000S00  -L 0&PB -LMx @6K;<$0 `100P`x5P D100V41001S 101 R01S0p0R 07036U $K(p_P`$0S d0\0P0D0 80$ ?BBBBBBBBB -Lؠ 00 Pp0000001Wp!`000V*0001@T00U0S T0PT*P`0V:\B?BB -LM☡ , `RR|1p1 p`100VC*P1000 Ha0 0Q10SU1: U/* 1%A`@`FV %Ph@p%|0T 0nH0h%|0apP000W:`,0S24`P`YV@ XCCBB-1C CCC`FV %_P&@L0T D00`&%A1w0$CC -LMx p, PRJ\1P1  @100U;*01000 (Q0 0a10SV): V'*1@`HEPEU  P U 0A!t0P000X:P,0S04P`@` ~CCBB-1C CCPEU  @PU <0@0$CC p-L 1>P 100S 0`A0200-P1S0&P000S 0`A00P1Sp0h00P P H0 D0p40p|(C,C0CB4C8C=@CDC -Lx pp100S@\100S H1`QPP% @1S@100S 1`QPP @1S00000S000@00P00t00h0 10\  0C0L0,0P{@>,C8CHCLCPCTC>BBB=?XC -LⰠ 00 R000@0S 8n0Ddid00 0SSD P<0U00 0 '0Ry8=>>\C`C -L∠ p000S P0U\0`101@PP P00Ux8= -Lp h000S 0PD000(@,101 0 R! Qx8= -L M , 00 2@0S P1110 1000x p1000@CTl1040 40`10Q(00X*10p@DTW00 1010p00 0000 0 Q OP O  O00 ,0$000(0 D00 0SS00000h7C xw8=dChCptldlCB>=0000h$0= -LX p`L100S<1MP1000U1@0,OP`P00UV0-+0P0000U0`@ $LP0UH0  8000 00C0u8=pCtCxC|CC -LD @0p`Pr@TPUsC -Lh P\2pX2X2pT2@P2@2y42P1 22011p1@ 1P10!`0C011111:Y`VPS`1T1(%8"S<1 0001$11pn1k0 00S 0@ 0S0S 00S000S0 X0MXp0008  s8CXC,CPCCBCCCBB=?CCCCCCC>CCCCCC -LM⨠ p` `FP000U|0000 l00,0 0 0AT0#03T03S  P, 0U0pBB -L┠ 00 0S 0000 l l00h60 \0030L000S (0do><CR@B8BC -Lt p00 0S `0000 L 30@000S 0n>< 8BC -LP L000S S 0 0m@>C -L\ T000S S  0 0m@>C -Lt p000S S T00 8#881400 00 0 m@>=C -Lp @h000S S L000A 800 0@0 0`tl@>=C -L† @Ul000S S P00 0800 00 07k@>=C -L| t000S S X00 8#880400 00 0=C -L$ 00 0 00j@> -L 000!Xj= -L 000j= -L 000i= -L 000i= -L 000i= -L␡ p10 PU x1000d1`UUT1pP1 0S  QP 1 0S  00CP v0 0S  @@0]fUU 0 000 00000S P00 0S @0000UUP Ti><ICCCC -LH @00P  0$  A gC -L -L 00@pPPT) `0Q  R:000eS 00@ 0 000e0C0 P 0S0'0S Pp@ @TT00(0TgC CD -LP @  0R00 p-L`P0Sp)  0S:p -L -LP 0$ -L` @P T $0T$@000 0  M8e= -L⸠ `pP' P$00fWE(00V00S l0/  @P0n @00e[TdDD D -LȠ pP+ 0 0`Q0P@@0P0P@cT @ ?00STP 0cD -L0P ; 0-L⠠ P@ T |0t0d00P <0 00<000@00 0 0bDDD D$D -LP 0 -L` @P T $0T$@000 0  La= 0-LPP @P 00 -L蠟 p@ y`vPT 0N0KI0FUVp0>p0; <(X00000 TP K  L$a(DDD$D,D -L p`PP J1@J:IP`pp0 %JPV cFV:P V `0D -LMM좟 @0,4 P `0 S T P22,pP2,l2 0S 0ST2,D28202$2 2jU  00S P 0`Y V V*00S P 00 l1`10T1 YX 00S 0$PMP U%*BKA ;@P`8#8S 0K0F(BKA 0 @PP U:00,T0IPD0,_4DD8DDDD -LMM⨡ K, `p RI@Px10 000 l1`1{uL1.@1$q$01Q*P 1R 1QY*K0 0*K00000 000@0;\00X0S `0 ?IH0TDDDDD(oEEE EEEEE E R 2@PbFB2@'Tڌ20 0S |20 pW l2` PDgH\2(L2#<2 H$2 @2:K,1NK@D+H10 P1 10 `1U  FYڜ1oNK@DkL1hI d1`NK@D\1Y@10  ),10l 1*K01GF1C0@0=0{:0v70q40l10g0:K0 0j$E(EE,E0E4E8ETEXE\E`E>dEhElEpEtExE|EEEEEUG0 LH00 60JK(@DP0EYI 0 :K(0C 00:#:00@h0dd1""*01FT400$ E EEEL< E 0E -LMMܠ P`00 p00 00 00 0,8 00 008 00 048 U ڌ0 fFP0@00PE\00 @2P8 @0rp00mz8NEEEEEEEEEE1^\1Y48S NK@D1D4DXW,8SY08S= NK@DD1DW41DNK@D 1DX1DNK@D0DY0DNK@D0D,Q0DNK@D0D0Q|0DK@p0D>K0C1P !P0088 ` 8088$ 0EEEEEEE=E -LD @004 40000'0K>E -L⼠ @P000 pgT0DP |0w T0DPa @5S  R(0JE>EEE~E -LM M† , 0 Pp00 8 T000SH0 0( < $000S 0jzIE\>FF10 `10 p10 10 10 048 10 PU NK@D1CCWVYX48S< NK@DH1CV81CNK@D$1CW 1CNK@D0CX0CNK@D0CY0CNK@D0C4Q0CK@x0C>K0CK 10 10000@08<(0L EEEEEEEEEEEE -LM0 `PpV pV  0,0 ܑ,K100S 0S ,0S1 e*<,K.,0SH @4@ <00 .1d1 X 62L10 D1?D@P141 (10 24 1 0 010 @ 0 K240S640 0 40 000 0S  P 4 K20 0 00 0 00` ^ p0[ V`F PP00P0  0G F FFLEFF4EF,E0E FE$F -LMMt 0 ph10 048 ,( K @L100S 0S ,8S1 )K @ .,8S ,.'104T 4E?P0*0 0 ?Pڤ [Q . R00S R@p00 @h0  X0 < j?P80" ]D(FF F,F0F4F8F-)T0 p00@0< 08) LEFHFLFE4EF,E0EPF$F -L | -L \ 00) 0  \  -L☠ 000 S X06 L0H0D0@0<0804000$ @TFXF\F`FdFhFlFpFtFxF -LP HH0D@4   "0Q01P?!|F p-L `0`000S 0 00000p00@0P@D0PTT`000S T0 00080 00p0000`p?TFFFF= -L⸠ @p`  @ @T |0P} 00`000@T@H000T 40Pj 0`@0Tb h>FF -L蠟 @pPS Q @N @Tʬ00`E 0E4#01T#000@T@l000TP0pP0`. 0E4#01T#@0T%"  =|FFF -LM⤣ p4 0 30304x30p30h3 d30 , X30P3P00D30<30430,3@?`? P`3F 0S280 P< 00@0 20D0 200S Y Y,0  0 0S |2 , 000S< @ ?P  @0? @ D0S =Y+4  4 0S 1 ,, Qz 0S < @?P  @0? @ D0S CY!8 @0S0D0f,  , 0S <0@d?P  @ ]? @0 0SrA dp000S8 6 `0+Y1T0O 0@0# @0T@0T4FFFF -LP`pQ 0R 00C R000Q 0@lT  D@0p 000@T @T0p 000 -LMp`P @At  0@Dt -LṂ `080 40 pXW3 W [R/ KpP 40KH000K!A0BS p p p p p 0K 40KH00 80Kp"R R R? R' R^ R R)  Rn R R ~R0 R R R W0 Kp 2gp80S @800C80 S8 K R*480080 80S +800C80 @#@80T:@ @40T:@@40T:040 80 8KP*@`@T  @8( 0@DSU8 K R*@ @40T: @D80R#804u)80S 800C80 S8 K Ru*@ @40T:3F @D80R8040 a8P^ 40@`0@80  ?8 0@DS400C40 BpR"PU680S 800C80 S8 K R*@ {@40T:t @D80R8040 ==4 80S *c4080 `00 8 K40KCG R RP0m400 000S!S 0 0000FFF 0-LM8 P ,0@0S@00Kf,G0 -L M `p000S0/D0P 0@<0  0(@000 0$0 00 0C(0 $0,0 t0 Vh0$R,KT0 V@H0HT [ ,>GG= GGGG0 0GG -LMM䠟 p8 `(hK00 P00 `00 00 0<8 00 0@8 00 00 @{H W8D 8(008( pGX00 0D8 H8S@000$+EEEEEEA>=DGHGLGPG -L ML p<1P@,11T 10G$4 0000 0C00 000 0,0 0P0`PA0S 4KP pW! t0d0 4K PH0 04'TGXG\G`GLG>=dGhGlGpGtG 0xG -L MT .P $00 <0000 0C0 $000 00 KU %>=$0Z0W0T`GTGLG -L MĠ pP 0A0>0;,$0,0 0000 0C(0 t000 0$0 P\0`PA0S ,KP pW ,KP $`GTGLG>=hG 0 |G 0-L Mh P@P $0$0 D0000 0C 0 ,000 00 $KT #>= 00`GLG0 p-L Mh @`PP $0(0 D0000 0C$0 ,000 0 0 (K T ">= 00`GLGp -L p@PY `@P0000F0V0H0X|0{ <d0tQ* 0RQ:40<"GLGGGGGGGGG -L⸠ 0 1R@QQ 0Aq  R  R Q!G -L0 4 8  -LMԠ Pp@`0  K0d` ;#;`S08#8`St0K`KAd0S P000@0l140h-l0hSGGGGG 0-Ll P@080r!L00 0D00$040 80=@Q0 00GGGG -L@  -Lؠ @`Pp `P0S K>@Q 000 8 b9=80pc@0S[<8P 40,0<?LGGGGG -L4 ,0 1RQHG -LM̠ p KtPd`KK@P  ;Ph0S x0pd0}\0yP0lu <@00llTGGGGG -L @P0@00T)P0` @T:08P  ? R00S RPPT0@P00T)D`<0p8P @T:GGGG -Lt `Pd0X0@T00T)HP@0p b9P @T:HGGG p-L\ PT0@P00T *@0`8P0Sp @T:pDGG -Lx P`l0@h00T*X0p0S j8Pe8P @T:GG p-L\ PT0@P00T *@0`0S E8Pp @T:p0GG p-L⠡ `P@1 ? R00S R 1`1#8P  ? R00S R $18P1pV@Tb@T 0S w 0 ap0x0p@PX0H0@@00000pGHH HHG -L(0  -L(0 -L(0 8 -L Q Q Q( 0 0( L40(0( 00( 0C 0,, -L( -L1S ( 0 (0 -L( 0 -L 1S   -L P`@pRp1 00@DV PpW Tp T00`@`@T P00@H00 X00R0S $0{X@HHH -L 0 0D H -L 0    H -LM⸠ @P, `R`0p00fpV I"(00g, S U P Qp ' P@ HP@T L00@D00 Y00R0S 0Y@HHH -L 0  h H p-L`P@Rp 0Sp @Tp 0Sp -LM✠ Pp`Q! 000S 6W 1 !0@KDP0 ~6 /00 /0C0 $=$H 0-LP@e6 0 -L@ -L$0S  -L 0S   -L 00x= -L 00H= -LM@ 8000S K00K00K w$== 00{= -L 00= -L  00 S`= -L$  00 "$= -L 00s= -L  00 = 0-L M4 P$@K  0p(H0 0-L Md P$@K D040 ~0,H0H(H0 -L M@K jr -L M@K! ]e -LM@K PX -LM @KM 0-LM0P$@K K5@T* @T:$K60 p-LMx Q d`,@K`0P!1 10A0 0R\, KL 00\00h 4H00000C0p -L| `pPA@Dd0000S T0 0R 00W4000@D R00 4H8H 0-Lؠ P00 R0 0@\0RP \00 xR oR 00B0 S a0BS0A0BS00000S00  R0 \> -L⌠ `0P00U*p0p4@ 4P0S PU:,00, ptld -LMMl , \1>T1 P10 80@<0@`p (1R% 1+1o0! !0f00 00P0U 10100 P0U@I,@T* R 0S 0S @T*0 S@1B^KPE $TH=>ptldXH\H`H8=0bS00T *0S S S@ 0 S S@00B^KPEH080YoT*0S SdHHH p-L` `@P0PV @0 3PQ VPPp\hHlH -L p-L☠ 00`0|0x0Pl0`000e@BDHADA@0 5ppH=tHxH -L, @P 0F@I -Lⴠ 0`P00p00A0 P 0S0S 0 0 0S 0 0 00S P UIHHH p-LDMⴠ P0+P(00 0@0`0 \K`K `0S @T \`K<@T700P@T/ -L 00H -L 00dH -L 004H -L 00H -L( 001!1 H p-L@MĠ P00 0S) 0000# !00`\@K%/t0.xP PU T0e/`40\0 '><H(I,I0Ip -L  P# @  ^\ Q D0 0000 0 00 0I$00004I  -L 00x4I -L 10 0S 1000 P# ̌@ˌʌ ̌ʌ\ Q D0 0000 0 00I$0000L><8I -L 00 8I -L࡟ Ps #+3i8eQ>!0>>8#8012Q6l!0:8#80Q2H!0:8#80Q.$!0<8#80Q*!0<8#80Q& 000Q& 008#80 0>>0 0:0| 0:0h 0<0T 0<08 008#80 0000hI0 -L⬠ Q Q Q 0 t0x d0l P04000S  08B@IDIHILIPI -L 0TI -L- -L- -L@/ -Lg -L -LM⼠ , 0 p40 0S& 0080 , 08 僑P@0 00chX4` 4 gN(&!"( @TPUp, 0, SXI -LM( p PY(,  8#hH$H,0# ! PUP( Ux 8#hH$H'   P(0U -L\ P qr@0@ 0SSP bYP \> -L M좟 0,2 8 @2 H2 200S2 0 2 2,@ p2 \2X2tv 0=D2n 07J!K*,2S 2 (@P 1181 )P1l 01n 0@@` 088RL ` KP" 0KT2 堐KpK00 S S S S0 S S) 0S `0 S 00 S S S S0 S 0Sn `0 S 00 S S S S0 SPW0SW `0 S  0 $>\I>`IdIhIlIpItIxI|I0 S S S S0S8 S`0 S S S0LSL `X$BP2T 3&3P3T"3|3l3L2Si T3pW*JOK`KP ,QKn 0JpW:p!U0b8#h] b("X  07@ T   0.W00T0SpGT0Sp1dm 0L2n 0PKR02sq 2n2k+ 2 g+ - R00S RXy 8B 'P< 1n >;y0K@0p`P K1p^0 A0 Sa0ASWAA0ASA7AU002K2E V03 00VP`&^0 S*0 S'@P00 S S Sp0`0d0*P @@k*P0S80IIIIIIIIIIIIIII82@ f'P< l2n >;pn >;kX 82n 0b8< K! pKK1 0RpW8FD 11*P1n 0CD"R <202 8#K'CP1 88 0< D" 8<\1 D2S <4 D1n 08KcP 1 8<C/K4< m 00n 00n 00n 00n 0eP m 0P0P,PX \0@X0 ,)@B QIIIIIIIIIIIIIIIX2 0S1 X`P3n 0P[K 0U*s@eTGX0 PP(00>;0L \ 0U:m 003n 0@@\K 0p<W3*bD"R CKK,*@QX2K<@gTI#X8" 0 PUp<(00~>0L \ 0i<2W:m 01n 0?@@\K 0qp<W<*10\2 <@g+ TK#X2\ 0D^ H\ .-H PU *8`,1  0RfPU:p<0(00~>0L \ 0<"W:0VX0DQ 0<0Hx00H"R`0Pm 0wH0n 0P00BIIIIJJJ JJJJ030e0.0@,H+0 k+)@ @B P0MH0I<0E00 A$0 J J$JI(J,J0J4J8JJ00@2 m 0$@n >;~|0n 0xh0n 0rTP@ T@2S ,0(0(P !000016 0x 0s 0n 0i 0d0`p000S L0 S0TJXJ\J`JdJw (hJlJ8BPJpJtJxJ |J$JJJ -L< 00,0@ 0 81QPdJ 0-L̠ @000S00\00 P0T00pp@p000 Sڔ!/"b1Q0Q00g0\JdJJJJ?gfffJJ -L@ RR$000JJ 0-LT @PH0 D00$00PP 0g00XJJJ -LMp , `(0S 0<00 L100S@10|410 p$100S10 10 @, P P02? uV =Kˠ~>2!a12c1`0##000  020@\VKˠ00E\Kˠ \ \JdJJAݳ Kˠ00\ d -L 00P XXJ -L⌠ 000S t00 0S d0000Q H000S ,000 J><8BPJ -LM\ 00K0C0KKD00 0S 40000P  Kd><00K  K p-L☠ `@000S00\t00 PT}Md0X0T0H0[_P0Sp`E0Sp\JdJJJJ -L M00+ =  -L+ = -LM`@pP0S6 S fsH s aWd h0f41Dd h0g1 ;W d h0f0"0q d h0g0"0eU 0d0 2Y&0eT0 2NU d h0d0 0@ Qd h0e0 03Q -LQ1 -LQ! -LMd \00 0S L0000 8000S 0S000 0><J -LMp , 00 \00 0S& L0000 0P @x0h>< '&(F@ T:P,0U: -L⸠  !("x8#h00 0S 0000PU)@T*f("(("(08#HT:08#XU:(>< -L0 ,000S 00  00 P\JdJ -L X -LMP KK K0K<00 0S ,0000 K_>< -LM⨠ @000 0S0 0000*p00 P `00 2 KH0 D0(P 8000lJ><>JJrEJJ00 0U> -L| `p@V PV00U0S  @00P@`> -L -L 00> -L< P000 > p-Ld @PT u`T np 0Hp,J -Ld @PdpT T`T Mp 0(J -LM( P 00,(JJ +,  &  !p ` P @ P@, 0 -LM┠ Pʄ0 p `  P @  0!0J -L| pPl0 ` P  @ 0 |J -L⌠ pP|0 ` P  @ hXH8&%$(#8J -LM4 @2pD`10X0 T@ 0KL0 0H0 0C80 40 XK08 )PP 0)H0@s K %`0H0S080KL0 0H0 XK'PP UH0@s K %XKr)U <0eQ $0_8JJJJKKKD@$0 00 0 K> p-L蠟 P0p `V01p0P0@&# U$0 WpK9DKJKK -L4 P 0 00 |>J -L M⼠ @P00 @T0@Q00 Q0H$0 0 0000 0C0 h000 00 T0 K W<P<0us,0p $> KJ$K>=J(K,K -Lh -L⠠ P P P x0 0h0 0 \0 TT 0 40 004000 00010>`IhI$JJ -L  ȠH$("0000S00 !00 0 200 000000S0l8#Ƞap0 !#000 .4080 !#000 .40@J`J -LԠ  Ƞ,0000S 00!02 0000S0`8#-a(X00'030,00!03 0J`J -L@@ !P -L0 S S 0 S S p-L @P0`0 !0^0Q p 0  R,$ 00S<" 00S,  Q:p鰽0K X4K p-L @P0`0 !0^0Q p 0 R,$ 00S<" 00S,  Q:p̼0K X4K -L M p`4PK@ a#`020K1 P104K1 P 1o100E`0#SL`4PK00M P @@4K ,100S 1I%`4PK002 P @@4K 000S 0. `0#S`4PK00 P 4K@D000S @ 8KLKPK 0}LK p-LM P@A`0000KKPt0[,h0,\0(P0$D0 00S 0KxTKXK\K`KdKhKlKpK00S0K00K 0>p -L?@`?@0P -LMࣟ @Pl! 3ZK,m"A 弓弃sc "!! 01 "SI* hK 011 Rp t xq |a 0 00h 0h!0㜈0 00d 0d!0cj 0 00` 0`!0w0 00\ 0\!0c0 00X 0X!0㜈0 00T 0T!0cj 0 00P 0P!0w0 00LP0L!0c0 00H 0H!0㜈0 00D 0D!0cj 0 00@ 0@!0w0 00< 0K 0C  0 S SK L00 Q00 R0SSK @@@ t PknWjpf \% X% FP50T%0b SfBK AP%P5`SP5h%0h5 U S S ECT0^:U`5S 0`5  l% ꀤKKKKLLL Lpdu 0l5 00 0S5WX%RF \5S7 㾭MK @DTt (0(RK @%0"tKLL -L∠ 0@0S 1P XP0<#  0,88# BRʀ 0PL! -LX 0AS <00 40 $"00#8#0AS`L 0-L P000S30000S 0000S x0p0@PX0 0@00 m0 000L L8B$L(L,L -L -L1`20`1` 000S -L0S r 0R r 0R 0S 0-L@P P P0 @0 p-LС 100Sl100S 15100x100S 0S  P <1(10 (10100 100S 0S   00pP 000 000@ 03 0.x00@Tp <0`\0PwP@Tp̜L8B$L(LF0L%4L8L8000S 01鰐L8BL -L8 40$,0$00HLLLL -L4 00 (0 00LLLL -LS P3 30R030 -LR P220 -L 00 00 LL -L$ @0 00@̎LL -L M 0,0 0  ,K100S \  0 1100\  0 p1,,0X1Xq01000 0140 0, 00`000pSV 0h0c@T P[00, @T0O V !V$ 9 ,000040@,0 000L00 4080{!ꄎLLLLMMM MMMM@,0T0g 0!,0000,000S0XM M -Ll @d000ST 00@00800,00 000鸋L -LMԠ 000S@0`0P0p0S 0S 00S K010S  $ $K0S \ 0 (LLLL0\  0 $#@T p-Lh @`0`\0P0S 0S 00S @TpLL -L -LM$ 00KKY0[D$M -LMd  l(KD000S \  0 00!0?!0?0!0?!{H100S@ 01>`!p0?L!j0?04!c0?0!\0;>!V0;>0 O0? I0?0 B0? <0?0 5(0001>0p0+Ć0M4M8M00SL200?@NJ`4#X L@200S 2111100`0 %4000P000 0@000 00X100 0<1P000@(100S (100 1y! 0s0@000j000c000\ 0\00S00040000;000 R0M@MMMMMMMMMMMM p-LԠ `000@S p ,7Pp!01US1S l0pP0@@P 02V  p80MMM -Ll @d000S T@000P$000!1>0 2@~0M -Ll @d000S T@000P$0001>0 2}0M -LMd `, T100P2Sj,1001>0P100S 1E1 0B00 | 0wY# 2p @`, R P P*@`l0_, 0@T* m@T: ,}0M8MMMMMMMM -L⸢ pP200S 1>00Sx2001>0@`4#X L@8200S (2222 100`0 %4000P000 0@000 000100 0`1p1l0 0 0S000 $000; 000 00Q0P000@000S 0000! 0`0@00x000`000H0{0M8MMMMMM@MMMMMMM -LMd `, T100P2S=,1001>0P100S 11 \0XB0S0 O 0JY# 2p @`, R P P*@`l02, 0@T* @T: xx0M8MMMMMMMM -L4 ,1,! v0M -L4 ,1,! v0M -L 0-Ll P @X000P@00000 2? 001. 000 v0MM -L -L0  @0uM p-L@ |`  wP r p -L@MP@K`P@ 0-L@ XP  S,0 p-LMp @ C`  >P P 6 0 \ KXtMp p-L@ !`  P  p 0-L@ P  ,0 p-LMp @ `  P P  0  K sMp -L$ 00!0r@MM -L$ 00!0Lr8MN -L 000rMN -L 000qMN p-L` P` @TH0o` @ 0D,0g`V0apqN NN p-LPx@ <`P\ p -L0S a0BS 0B00S 0-L@ R A0BS 0  \P.00 R A0BS 0 @  \T@000 -LԠ @0000?  B0!R0AR001 00 BR 00 BR00000@ 00oNN p-LM@Pd0S S *S 'll0U0   0PlD0U01 Ql`K  1[021[:01KK p -LMP@`  0 400T0V03S; d 0(0 R R #R l 00(0 , Sl014(0 S24(0 l0(K (0#2(0 (0:#:(0 (`g@$00T0V03SX` -L,M⼢ p0 `40 @ 8 0<   P  @ H 0L0 1S$0 0 4 @ L0H#D ` P 40S1< Q1G@0Sx 1>s0F8 D#@100S|1.4 <0XU1$*T10T0 T0S@1410 \00P  0PW 4X! P@< XU1:d 0,0 R R "R l 00,0 l014,0 | S24,0 l0,K ,0#2,0 ,0:#:,0  lN N$N(N,N0N4N,`PH04VX:4 4X0#03V0S 08N -LM -LM `@p0TTG 000S 0d 0,0 R R !R l 00,0 Sl014,0 S24,0 l0,K ,0#2,0  ,0:#:,0 Pi(N 0 #K6Y KP KP!x000S h0 *K*K" 0 \dNhNlNpNtNxN(N|N 0S -LM @D pH 0 SG X00W0S@ nKĐ]K 0S/ R- 0 0H1 Km$H1S . tDaP jK+DRP$ZN0H1 R X00W0S -LM$MD KL!@RoKPKJK21/1@+1(&$1!(1[S:  PqX Pl100S \1JKL1D1 B!01<$18UZEMK@D  1! (0v` X0 0000S 0t`K *@P& t000S |0 〩*KL! 0:KLXNhNNN(NNNNNNNN 0N 0-LM8 P@,0T(@KUVN@080 !$00NNNN0 0-LBM∠ @P|000S l0 0S 0S 0S 0 PK? U KTU(NNP 0S0 p-LM MP j8KP 0S`-0[ JK8@D X 2[![(0t0T ၻ8Ksp p-LMP`P 0 @00   0Ka 000p p-LMP`P 0 @00   0KC 000p -L -LP 0, -Ll Pp@4ߺ`4 D000` P 0S1!800RN -LHM0 8 P0<0 p#80\0383P{Pw 0@0 0D0 0 4H0  0 4 @@L  1S$"P 1S$T 0X0 0\0 0S0S 0 ` p`1S@$@0 0 4 @v#d 0S0S  0$ p`1S@$@0 0 4 @v#0 ch 0S0S 0 p`1S@$@0 0 4 @v#0 c gl 0S0S 0 p`1S@$@0 0 4 @v#0 c C0P`,RxN2P``200S \ェ4@K 22200S3 2@2D|2Hp2Ld2PX2TL2X@2\42`(2h2d2l2 0t`pd`H0p0Bᕹt`P0p0 V*80p0 0P< N`V:4100S `1UtT0h0P$ll0 1S$0l`@T *80 0P< #@T:000S 0*l@\000S 80x@P 0< d0@Ϧ<(NNNNNNNNNNNNNNNOOO O -L@P0` h0lpU *\ `0 P`0PU: p-LР `P0@P0pP  P0 Pp0 X0@P T000p80000t5pKOxOOO O$O -LM MĠ @0P0S- A K T0t&|0pA]K 6`0X0JK @Dj 1!(0JO(O,O0^0O -LM蠟  n@000d 00 R R "R l 000 | l0140 h S240 l0K 0#20  0:#:0 I4OO0Z8O p-L┠ @ "`  P 0S 0S 0S,0p 00 0{pGO`OdO 0hO -L 0>lO 0 QaB! P`BP:QQ1121:QQ1101:P@  !P@ !!P!@ #!!P@ !!P#2!\`B-0QaB+ -P`BP":QQ1121:QQ1101: P@ P@ !!P!@ c!!P@ !!P#2!" l!\`B-Q 0 P:QQ1121:QQ1101:P@  !P@ !!P!@ #!!P@ !!P#2!-pQ& 0P1QQ1121:QQ1101: P@ P@ !!P!@ c!!P@ !!P#2!"l!-C -0 LC -0 L C -0 LC -0 L C -0 L C -0 L C -0 L C -0 LC -0 L C -0 L C -0 L C -L0 S05 57C -L0 S05 57C -L 0S B0S0 -L0 P- P 0NNDH 00"00" 0#0 0\LS S 0\LS S 0\LS S 0pS S -L 0P P cc -L0a C0S0 0c 0S,0S(    -LR%"A 0P0P0S l 0P0P0S 0P0P0S 0P0P0S@T R  0P0P0S Rl -L@R!"0S0 0S0 0S0 ^ 0S0 0S0 0S0 0`0c S  0 R0 S0 R0 0-L@@0PPP0 0-@LT0 @^, ^^0   R" R  R R R R @0PS R0  0SR0  0S R00 -LZPM 0\J0g  * @0SAÔAXApAI H@7  0@#  0@L S ,0 , K0K0 0S `0Q 4 4 K8K8 0S ` S <0 < K@K@ 0S ` 0Q D D KHKH 0S ` @T S L0 L@KPKP 0S `v*Pa pf0S0A@AAALHP ? P) @@P@746 S@ T0 TKXKX 0S `B716S \0 \K`K`@ 0S `2726@S d0 dKhKh 0S `"716 S l0 lKpKp 0S `PU746S t0 tKxKx 0S `P 0 Z 0\Z -L@p`P0eS!:T0g0@c S 0 R0$!$!0P`@ R% 0 R0 P`T0@c S 0u R0f$!$!!0Pc`c@ T 0u R0f0R BR  BR  BR BR B  b -L@p`PT0g0@c S 0 R0$!$!M0P`@ T 0 R0 -L0S$A AàAðAAAAA0@ &@ 0@  @ 0 @ @ @0 B000 0000 0  R -L0a pf0SAAèAAPA @ @ @@P@ B756074607P<60 @7>6 0 R7560 -L0S-AAÐAäAøAAAAA@ 0. A@ 'A @ 0 A@ A@ 0A@  A@0$A @ B 0000 0 00  0 R -L0a pf0SAAøAA A@ @A@  AP @ A@@ BP7 56 07<607@>60P7460 R756 0 -L 0S NNDH00# 0 " 0\LS 0SL 0S 0SLL -L@Q  T,000 0 ! 0 !0 0 ! 0 !0 0 ! 0 !0 0!@D0 "0 0!T "T (000 0!@T "(pO -L 0 'pO p-Lx@M\ X0 P 0<0 80 `0\PKL0 H08 @P@TH00(\'tO#Tp p-L`@ԡR  80S01RPPU pTp 0PS1(P $0Sh1 $ (  PpPV P`f0 00FSP $0S P Y($P0 `R0 &>PUP T ^ $0S (PT ^  0  S0 00p&xO|OO p-L`t@P  0S 0SpV``P0  R* +Pas0Sp0C0   0P00S "0 #20S|"000S 0C0 0  0P8! c0#22cQ " 0000  00000S 0C0   0 <0P 000S 0C0    080P 000S 0C0    040P 000S 0C0    000 000p 00 0C0p Pu0 AUPUT   0PS 000$OOBOO000S< 0C0   0 <0P 000S* 0C0    080P 000S 0C0    040P 000S 0C0    000 PR 8 0000  00pppO p-LD@P  Qp0 S 00  \p0PQ0` 0R Ra\  Q000e000Q p`TP Q    0S000_`P 00pO -L@P P $0SP k($00 -L`@pPP 0S 0S  00P 0 0 4 3@C d` n 00 -LP  R@@@@ 0S000  -L0 y -LP P PF -L`p(@  @P(Z. PU$P($(  PU(P($$0,08 (040\00   <0 -`ȣLMLP 0T0 P p4L X 00 ^*0nC,0Xa0 SniiW T R  P0L0 0 BT pWP @ 0 SI ),ꨁpG@8pd00,K0K4 K80K``,04 80'P  pTP  X040P 1ꨁpG0ꨁpG0 00威 pGpT P00X4P0 b001 W T R P0L0 0 BT pWP t1((0R 00 pT P00X4P0 b00 1 pR 0S000T R  p P00X04PL YH,X R 00( S X R*0bCX0cY6L X44X 00L Q*0aC,LOO,0X bX0S 00( S X R*0bCXnY  pTP  X040L P{L XT @PT@! T @! +P0TXdT X 0P0 0 d0dS00S00 W T R P0L0 0 BT p WP I$I R@2P 00 pT P00X4P0 b002 .(  P  pT  P00X4P (pG00 0 #50R*2W TQ L P0AT pWP  0稁pG0  #50R:@P p1 0P 00` $0 @P ( L@ $t 00 pTP  X040L P@00@20<0  \@ Q` *@W *TQx L P0AT pWP :H0! @Y 08 pd00\OOOYI  0W* TQZ P0L0 0P pTWAT :8pd\@pl" , 1 080`0Q\00YQ ( $ 00 pT  P0 0X4P0 b003 7Y 0` 1 0^ @20<0  \@ Q` s:00 < 0@0 @@0K0D K H0K0<0K`  $ 2@( $T t pTP0X 4 P `<@D H0P  pTP  X040P  pT  P00X04PL l 00|L P L P  T 40 X0 00XL Qp*0aC,0X b0SM 00L X0404X 00L ^0 40R pTP  X040L P00 pTP  X040P o pTP  X040P a pTP  X040L PS pTP  X040L PEO pTP  X040L P6 pTP  X040L P( pTP  X040L P pTP  X040L P pTP  X040P 0l 00 0-L@PR<0000CS( $0S (0840\00   <00 p-L@P0`0CS( $0S`` `(0840\00   <0(($($$($p 0-L@P(U(0040000 -LP -LBM pd ` \ X T P L H D  @ < 0 8  4 0 , d`K( 1 1 !0^00d0SQ`0 (S!  Q1S  1S01\1  ^ 1S 01 1 X! Q * 1 \ JQ : 0 Q  Z q` K! 0 0 K K^1 qc 0^  !Q!  !000^: 00  ! p Pp a q1$1 Iy  (  `R]0 q(p!0hQ! h(   0 P,! 0@i1$ 1Q *Qc Q*0P,! 0ZSy K R0 !<D 0@1 c0B!1 > 0bQa!0!0`Sp<hD1!S:?0@q0 S *S ` 0@P p0b! P @Q >1`IpQG*!1!00qQ: ..q8(0C ( 1 q@ Bc( 8 0C!0Sy=\ *  QR -L `| M0 @,` Pp ( P" @0  P,0K00  \@t0 Ot 0 0S 0 @ ( $O -LT$M, `0 P (4   pPZ 0 ! 0,Kp0 @ 4@@P0St0 9t8 03 00  0p 040 @0@@P 0L V00R0S t40 t $0 <OOOOOOOOt 0 @ ($O 0-DL@@ 40 @P@ P0OOOO -PሣML0 @ `4, 00 p^*0nC,0n83080 0 S:~F2\ Y( `00 0400 b00 00`0  400, ^`*0nC,0n, R R 00000 0 0 V *Y 0 0,0 0I`V0 :8 101 08`bS 00  00 00@Z  00 00 `00 0400 b0041 V *YH , 0 0I`V0 :0080!0 00 0`a 80 V *Y5 , 0 0I`V0 :8 101 08`b 00 0 0:@ 00103OO 00 `00 0400 b003 %V *Y , 0 0I`V0 :8 1 `a 08 (0 0cS*, 0c c4 a4 0SA \/,^ 00( S ^*0nCn\, 4400, ^*0nC,,0n^ 00( S ^*0nCn\ 404 0 , ,0LQ(040 00CS000\9,^ 00( S ^*0nCn\), 4400, ^*0nC,,0n^ 00( S ^*0nCn\  `04, v0, 0LjV`F0  B0 , 4400, ^0 40R `0004, Q00 `04 E `04 ; `04, 1O `04, & `04,  `04,  `04,  `04 00l 00  -Lp@P`(  P 00p@P` -L 0($ -L`0P4 p U@e,0@e08T@!y  T R\ 0d0   <  <0 , PU$40(PS4P40 8@eT@!y00T0S\0 d 00 <  <0 dP 0P -L\$Mp` P40@, 00 X* 0h0C 1fP! PAD@`` p`p4 ,00h40 "0D0 8 < 0`FT@T8, 01\4 A4 5R0@b0D05S@co  @l 1T 05\0`FT@T< 0D01!@  H 05S@c2 40  T( `L *0`FT@ T:@ 1@l4 00L5\ aR:c00 @ b ,0 Pll0\00(0P0M@@ 10H 0  P1fP!AD@`` p`p4I@ Q 0f P1P!AD@``p`p(04 0a 00xOOO 10\b40A4 5S @c t 4 V00^\< 1fP! PAD@`` p`p4 0 b00 -L0pQ (M( i(Qd 1(`( V`! fV( E0  L L@P, , 0 00 4  8  8< < @ @0D `FVH 4p   D H  V 0`V @ <7&c2 c8'6b"(b^q -0 LRE=( -L0   HP -LM( , p, 04>0!C6 ( `WQV(0!  l P@ 0R , p0`4>0#V -M`LHD0p( !Q40U*0@ 0? Q    P( H D0"#41U:Y  -LP@Q @T 0ST 0 S P ,0-`.Dp/34081 <2P<0 =>^?4 8 J<100&0!^&d"ZP 1G80S9 54' /- 0 R) 0 R" 00 12@3$( ,  00 12@3$( ,O 00 12@3$( ,W lPP p-LPQ`N ,0-./4 8<0@D80S954& ۿ0 0R+ 0P% 00 12@3$( ,  00 12@3$( , 00 12@3$( , pPUp -L`ᠠM0 V)*0,0 0f000 ,0 0$ R0 @0p P  4800$0!^$D"ZQP `V: -LpM@p P`00^:\00P`80  0RS00>P`00^:PP`00^:P@P 0p4 @P`W&20D0 P 0RS00>P00^:D00 0P 101@ `V0Pp0RPPph P 40pq 1P01\P)` 0RS00600`V:D 8 U40q 8 0bq 101PP0P`Pp 0RS00>`p00^:P` Pp 0RS00>`p00^:Pp80U84Pa< Ue0PePZ P0pq 1P01PP` 0RS00600`V:8 0q P1P01.P`Pp 0RS00>`p00^:` Pp 0RS00>`p00^:Pp<0U 2, p-L`P3M@0,0S0 0S0 0S 0o = R0 ; R 0BF> !\  000 0 (0C$0 a0C 0S0 0S0 0S 00Ip -L` > Last link date: Contact: bootldr@handhelds.org >> Last link date: >> Contact: bootldr@handhelds.org Cpu company: DEC Cpu Architecture: StrongArm Cpu Part: SA110 Cpu Part: SA1100 Unknown Part: Unknown Architecture: Cpu company: INTEL Cpu Part: SA1110 Cpu Architecture: XScale Cpu Part: PXA250 (Cotulla) CPU made by unknown Company: revision A0 revision B0 revision B1 revision B2 revision B4 processor ID: >> ARM Processor Rev=>> (c) 2000-2001 Compaq Computer Corporation, provided with NO WARRANTY under the terms of the GNU General Public License. >> See http://www.handhelds.org/bootldr/ for full license and sourcesPress Return to start the OS now, any other key for monitor menu Rebooting...parseargs: argc= haystack = <> needle = < helpboot> quitACK0 partition -- displays the partitionspartitionpartition show -- displays the partitionsshowpartition save -- same as params savesavepartition delete -- deletes a partitiondeletepartition reset -- resets all partitions to the defaultresetpartition define -- flags: 16 for JFFS2, 2 for bootldr, 8 for rest-of-flashdefinenpartitions= base: size: end: flags: usage: partition delete part_name usage: partition define flags 16 for JFFS2 Error allocating space for name +basestr is "+" jffs2 bootldr sector must have flags set to 2 bootboot command failed, entering monitor Probing bank0 memory size... bank0 memory size=0x in megs: M MDCNFG=Probing memory size bank= dram[0]= mem_size=[i] mem_saves[i]=maybe mem_size=found= mem_size[i]= memory size=probe_ram -- probe for ram size and banksprobe_ramn_banks=dram_sizes[0]=dram_sizes[1]=&_start=FLASH_BASE=boot_flags_ptr=*boot_flags_ptr=boot_flags= enabling mmu setting flashword=probing ram DRAM size probe failed! SDRAM size: jffs_init_1pass_list failed to initialize DEBUG BOOT: not evaluating params DEBUG BOOT: use `params eval' to evaluate parameters. type "?" or "help" for help. flash_type [type] -- print available flash types or set the flash typeflash_typeflash_width [16|32] -- print available flash width or set the flash widthflash_widthflash_width=32 16 1632Invalid width: must be 16 or 32 md5sum md5summd5sum file [partition_name]fileUsage: md5sum file [] Usage: md5sum [] Usage: md5sum
[] rooterror parsing base addr: error parsing size: display display -- dumps the SA1100 registersdisplay SA1100 Registers: UART: UTCR0 0x00 UTCR1 0x04 UTCR2 0x08 UTCR3 0x0c UTDR 0x10 UTSR0 0x14 UTSR0+4 0x18 UTSR0+8 0x1c UTSR1 0x20 load flash -- xmodem receive to flash (see override param)flashloadusage: load flash error parsing flash_dest That is bootloader space! Use load bootldr. Operation canceled load ram ramusage: load ram error parsing img_dest bytes loaded to uncompressing gzipped bootldr bad unzip of gzipped bootldr Not loading invalid bootldr into flash Looks like a gzipped image, let's verify it... invalid gzip image. Sorry... img_size is too large for region: programming flash... unlocking boot sector of flash erasing ... erase error! writing flash.. addr: data: error while copying to flash! verifying ... calculated crc32 = 0xdesired crc32 = 0xerror programming flash (crc check failed) error programming flash at offset= src= flash=not checking any more locations formatting ... done. load flashregion -- upload an image to the flash. dangerousflashregionCan't load to partition <> while running from ram. Operation canceled loading flash region using ymodem using xmodem download error. aborting. img_size is not a multiple of 4 -- are we sure that's OK? load [partition] -- xmodem receive to flash partitionload params -- xmodem receive to flash partitionparamsError: no partition named Here are the defined partitions partition is a bootldr partition: requiring a bootldr or parrot image. is a jffs2 partition: expecting .jffs2 or wince_image.gz. is a kernel partition: probably expecting a zImage. After receiving file, will automatically uncompress .gz images bootldr:program program could not find flash partition programming flash partition ram src = len =usage: program save Could not find partition About to xmodem send flashword= base= nbytes=download error. save all -- upload all of flash via xmodemallsave flash -- upload flash region via xmodemusage: save flash error parsing error parsing flash_dest=flash_size=save ram -- upload dram region via xmodemusage: save ram error parsing ram_dest=ram_size=peek ram -- reads 32 bitspeekpeek byte -- reads 8 bitsbytepeek short -- reads 16 bitsshortpeek int -- reads 32 bitsintpeek flash peek gpio gpiopeek ram requires arguments! error parsing addr addr = value = poke ram -- reads 32 bitspokepoke byte -- reads 8 bitspoke short -- reads 16 bitspoke int -- reads 32 bitspoke flash poke gpio poke ram requires arguments! error parsing value poke ram: addr= value=flash write failed! breakpoint [delayed] -- TODObreakpointdelayedPC breakpoint will be set after kernel unzip at: Setting hardware PC breakpoint at: Clearing PC breakpointqflash id | security | qflashqflash requires arguments! idsecurityvalue = eflash | [] | chipeflasheflash requires arguments: | []|chip! erasing partition chipCannot erase whole chip without setting override to 1. erasing flash chip error parsing addr: addr=error parsing len: len=Cannot erase first sector without setting override to 1. pflash 0|1 -- (1 -> protect, 0 -> unprotect all)pflashpflash requires arguments: 0/1 (1 -> protect, 0 -> unprotect all)! error parsing protect: error protect value must be 0/1: addr= len= protect=Region specified is out of Range. Please use a range less than:call [a0] [a1] [a2] [a3]calljump [a0] [a1] [a2] [a3]jumpusage: call [a0] [a1] [a2] [a3] last_ram_load_address is 0. error parsing vaddr Calling fcn= a0= a1= a2= a3=physaddr -- returns physical addressphysaddrphysaddr requires vaddr argument! vaddr=paddr=sectionDescriptor=invalid baud rate: Please, try: 110, 300, 1200, 2400, 4800, 9600 19200, 38400, 57600, 115200 or 230,400 update_baudrate: new baudrate= baudrate changed to 0xMMU Control word=cmdex [0|1] -- use extended commandscmdexuse_extended_getcmd=0xAutoboot is DISABLED aux_sar -- aux serial dumpaux_sarledblink [on time] [off time] [off = 0] -- blink the LEDledblinkttmode [1,0] -- go into ttmodettmodeser_con -- start a serial console sessionser_conserial console at your service... irda_con irda_con -- start a irda console sessionirda_conirda not available yet, starting serial console. memcpy [size]memcpymemcpy needs args: dst src num [size] bad dst param bad src param bad num param bad size param memcpy src: 0xdst: 0xnum: 0xsize: 0xBad size: 0x| hex_dump [size]hex_dumpreset -- software resethalt -- power downhaltFeature not available on this hardware. addr1=0xaddr2=0xw1=0xw2=0xmemcmp [size]memcmpbad addr1 param bad addr2 param memcmp a1: 0xa2: 0xver -- display version infovermem -- show info about memorymemFlash memory info: SDRAM memory info: SDRAM size:SDRAM bank0: mdcnfg = 0x mdrefr = 0xmemtest -- test mem between addrsmemtestmemtest needs args: addr1 addr2 seed bad seed param bad fillval param store vals . cmp vals mismatch, want: 0x got: 0x addr: 0xmax_mismatches exceeded, aborting. cmp done *********num_mismatches 0xtestjffs2 testjffs2 -- TODOtestjffs2read which file??? bad dst param copy the file to where??? infojffs2 [partition_name]infojffs2timeflashread [partition_name]timeflashreadls [partition]ls/load file [partition] [filename] [dest] -- jffs2 read filecowerror parsing clearmem [num] [dst]clearmemcmpkernels [dst] [src] [len]cmpkernelswhich kernel partition? bad len param enable_caches [dcache] [icache]enable_cachesbad dcache param bad icache param asmEnableCaches = out of room to build params list! + pef [just_show]peflli -- low level coprocessor infolliARCH INFO(CPR0)=MMU Control (CPR1)=TRANSLATION TABLE BASE (CPR2)=DOMAIN ACCESS CTL (CPR3)=FAULT STATUS (CPR5)=FAULT ADDRESS (CPR6)=MMU PROC ID (CPR13)=BREAKPOINT (CPR14)=Program CounterC (PC)=cat [partname] -- show file from partitioncatcat what file? jffs2 read [partname] -- reads jffs2 file into dram at dstaddrreadwhat dstaddr? what file? Reading file: from jffs2 filesystem in partition: . Writing contents of file to address Number of bytes read is wrong magic: wrong arch: Not linked for flash, start_addr=Does not support this CPU, boot_caps=BSD checksum nonzero parrot word 0 ->0xExpected ->0xparrot word 0xFFC ->0xor ->0xparrot word 0x1000 ->0xExpected ->0xwince firmware 0 ->0xExpected ->0xfirmware word 0x40 ->0xfirmware word 0x1000 ->0xExpected ->0xYou must load wince BEFORE loading Parrot discover -- guess what machine I am; see mach_type for resultdiscoverMachine type--> iPAQ 3800 Machine type--> JORNADA56X Machine type--> iPAQ 3100 Machine type--> iPAQ 3600 mach_type ->initialize_by_mach_type done tdz -- test decompress routines (best with ASCII) preflashingtdznot enough args, need error parsing address error parsing dAddress verify img = uncompr size = finished loading with runningCRC = 0xuncompressed length = 0xtotal_in = 0xread_crc returns = 0xcrc32 static calc= 0xErasingEnd Detected Skipping Copy of Flash no control function 28F128J3A_1x1628F128J3A28F640J3A28F160B328F160S3No flash descriptor: reset flashprogram flash worderase flash chiperase flash sectorerase flash rangeNo flash algorithm known for CFI vendorID=the flash sector needs to be erased first! flashAddress= flashWordOffset= flashContents=programFlashWord error value= status=intelFlashProgramFlashBlock XSR= sr=final status=programFlashBlock error intelFlashEraseChip unimplemented eraseFlashSector: sectorAddress must be start of a sector! address=nsectors=eraseSector error sectorAddress= timeout=Erasing sector startAddress :limitAddress :Protecting sector ERROR - status=status=Protect=(1x16)startAddress :(1x16)limitAddress :ERROR - status :status :Flash types supported (2x16): Flash types supported (1x16): Current flash type is Flash size: UNKNOWN! setting flash type= Unknown flash device type: for flash organization: 2x161x16 get root partition failed assetbtflash_add_partition: could not allocate memory for partition table allocated partition_table defining partition: no partition table! no partition <> found partition <> deleted QRYNONE Flash style = verify flash size... verify flash size failed. btflash_init: mfrid= devid=mfrid=deviceid=walking flash descriptors () btflash_init: found flash flashDescriptor= flashSectors= nsectors= flash_size= flash_address_mask=btflash_init: FAILED! Unknown flash type! protecting the bootldr no control function flash_addr_shift(): bad bt_flash_organization=flash_make_val(): bad bt_flash_organization=flash_write_cmd(): bad bt_flash_organization=flash_read_val(): bad bt_flash_organization=flash_read_array(): bad bt_flash_organization=flash_write_val(): bad bt_flash_organization=no control function Snoozing... ******** malloc out of storage ******** size=flash_iohandle_prewrite: unprotecting bootldr rc=eraseFlashRange returned rc=error while copying to flash! flash_open_iohandle: no partition named : out of memory jffs2_open_iohandlehda1:copy src dst [len] -- copy from src to dstcopyCould not open source Could not open destination destination does not support writing. srclen=dstlen=nbytes=command_copy: read failed err= addr: data: : write failed err=paramsbootldr:usage: copy srcspec = | | hda1: [] xmodem_initial_timeoutxmodem_timeoutxmodem_one_nakready for xmodem download.. startingRX PACKETTIMEOUTBAD BLOCK#BAD CHKSUMDONEABORTEDWRONG BLK Download Failed! Download Successful timeout nakgoto againboot [partition] -- boots off the specified/default partition (see boot_type param)bootwinceidevfatbooting ... kernel partition base kernel_magic=no boot image in flash kernel_region_words[9]=Linux ELF flash_imgstart= size= dest= offset= MMU Control=MMU PIDVAM=copying Linux kernel ... done Skipping kernel copy by request. : Copying compressed initrd from to ...Done root_filesystem_name=Grabbed linuxargs, argc = Using mach_type pre unparse setting boot parameters to setting boot parameters to linuxEntryPoint=Booting Linux image CP15 r0=CP15 r1=CP15 r2=CP15 r3=CP15 r5=CP15 r6=CP15 r13=CP15 r14=copying NetBSD kernel ... netbsd done! Jumping to 0xF0000020.. Unrecognized kernel image boot flash [partition]flashkpart=cannot find kernel partition named >< booting kernel from partition > nfsroot= ip=::eth0 initrdboot wince -- boots WinCEboot qnx -- boot QNX/NeutrinoqnxBooting QNX... dramFound a QNX kernel @ 0xERROR: No QNX IFS found - searched from 0xboot addr
-- boots a kernel loaded in DRAMaddrnot enough args, need
error parsing img_dest error parsing img_size boot ide [ide_num] [ram_num] -- read kernel from ide partition 0, ramdisk from partition 1warning, no sleeve detected. attempting pcmcia insert anyway. Reading kernel from partition number noinitrd Reading initrd from partition number Booting ide ... argv[2]= boot vfat [filename] [args...] -- boots off VFAT partition 0 (on PCMCIA if possible)Mounting vfat on partition vfat mount failed rc= Reading params from file: /boot/params boot/params. Reading kernel from file: read zimage failed rc= Reading initrd from file: Booting vfat... boot boot -- boots the bootloader, againMalfunctioned Failed BadPacket End of Text End of Session Timed Out Transmission Breakdown Buffer OverflowUnknown Error totalPackets= Transfer timed out Transfer canceled by reciever ackcnt=nakcnt=GOT a ACK GOT a NAK Transfer canceled - Maxuim error count exceeded Upload Successful Transfer may not have competed Bytes Transferred= impossible condition #876 flashDescriptor is NULL! throwaway_bootldr_partitionparams_eval_file: tmpPart->base =params_eval_file: tmpPart->size =/boot/paramspef: loaded a file of size failed to load params file /boot/params ... boot jffs2 [boot_file] -- read kernel from jffs2 file (see boot_file param)jffs2bootcannot find kernel partition named >< booting from partition > nfsroot= ip=::eth0 loaded file of size = 0x at location 0x ramdiskrootAttempting to output file could not find partition root part size =no kernel found partition is of type returned = no loader found for the partition invalid partition copying Linux kernel ... done cmp failed at i =pF =*pF =pJ =*pJ =kernels match up to Verifying gzipped image . verifyGZipImage: calculated CRC = 0xverifyGZipImage: read CRC = 0x1.1.3inflateInit2 failedinflate error :0xstream msg = calc crc32 is 0xread crc32 is 0xfinished loading with runningCRC = 0xuncompressed length = 0xtotal_in = 0xread_crc returns = 0xcrc32 static calc= 0xhelp [command] -- Displays help texthelp ?apropos -- searches for text in help descriptionsaproposapropos Trying to load help... you can't execute the cmd <> while running from ram Don't understand command RXSTAT error: MSG/ *0x == HEX_TO_ASCII_TABLE corrupted strtoul: leadingZero nchars=strtoul: base16 nchars=strtoul: base8 nchars=strtoul: c=baudrateautoselectosjffs2boot_typekernel_in_ramkernelautoboot_kernel_partforce_unzipnoeraseoverrideicache_enableddcache_enabledentryuse_initrdcopy_initrdinitrd_startinitrd_sizeinitrd_partitiondram0_sizedram1_sizedram_n_banksmemc_ctrl_reg noinitrd root=/dev/mtdblock1 init=/linuxrc console=ttySA0linuxargsmach_typerootkernel_partitionboot/initrdinitrd_filenameboot/zImagekernel_filenameptable_addrhostnamedomainnameipaddrgatewaynetmaskdns1dns2netcfgnfs_server_addressnfsrootverbosecmdexjffs2_sector_marker0jffs2_sector_marker1jffs2_sector_marker2/etc/bootldr.confconf_fileboot_vfat_partitionreflashrecb_cmdser_concalb_cmdboot ideconb_cmdboot vfatqb_cmdbootstartb_cmdupb_cmdrightb_cmdleftb_cmddownb_cmdaction_cmdsuppress_splashautoboot_timeoutsplash_filenamesplash_partitionymodemymodem_gboot_flagsenable_mmuget_param: could not find parameter params_eval: prefix_in = params_eval: just_show =eval param blk found partition table in params sector pt->npartitions=partition_table_size=+params eval [-n] -- shows the parametersevalparamsbootldr:-nparams -- displays the parametersparams reset -- sets the parameters to default valuesresetsetting params to default values flashword = bootldr_params = FLASH_BASE = sizeof(bootldr_params) = setting param <> to value <> set =setshowshow params show -- show parameters>> = <=<=<0xparams save [-n] -- write params to partition, if existssaveflashword=0x&__params_begin=0xFLASH_BASE=0xdefaultParam=0xbootldr: set "0xNot erasing and writing params sector. No params partition found. I cannot save params into Wince or JFFS2 files!!! no control function actiondownbleftbrightbupbstartbqbconbcalbrecbplaceholderAuxm checksum error, csum: 0xmsg byte: 0xBad state in auxm_process_char, 0xauxm rx status: 0xTimeout on write, stat reg:Initializing aux micro this machine has no auxm console char read, exiting _cmd no control function 31003600h3800_control_egpio: error - should not be called 3800h3xxx genericgpio_init: unhandled mach_type=.~~~~l|88||88|888||8<<><~~<ffffff{>a`<|0f8l8vv0 000 0 0f< [inc] -- fill lcd displaylcdfillNeed args: color [inc] lcdbar [percent] -- fill lcd barlcdbarNeed args: color [percent] Need args: start_row start_col end_row end_col percent direction color percent: 1 .. 100, direction: 0 - horizontal, 1 - vertical Need args: start_row start_col end_row end_col color Need args: start_row start_col end_row end_col lcdinvertregion lcdinvertregion1.1.3inflateInit failedmemcpy 0xreset obuf inflate failedinflateEnd failedabout to display lcdzimg -- display gzipped imagelcdzimgneed args: len img too big, zbuf size: modem_rx returned, rc: 0xdownload failed. Aborting lcdzfile [filename] [partition] -- displays a gzipped PNMlcdzfile/boot/splashz_linuxrootbad splash load for file: splash -- display the splash screen (also see lcdzfile)splashlcd fb max = P6this is a ppm file P5this is a pgm file unknown file type, exiting... bad width bad height loading pbm from location: of size: fb at location: error reading pbm header width :height :maxVal :data :xjVp $ν|*ƇGF0FؘiD[\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆuse_ptableuse_mtd_cmdlinejffs2rootfstypemdcnfg=mtdparts=ipaq:,0x@0x()ro rootfstype=Making core tag at Making cmdline tag at Making mem32 tag at Making initrd tag at initrd.start= initrd.size=command line is: no control function inithal_ops=detectopt detect= usage: hal init hal detect hal init -- initialize hardware abstraction layerhalhal detect -- detects hardware abstraction layerUnable to generate CRC16 lookup table ready for YMODEM transfer... Receive buffer too small () to accept file size Sender exceeded size of receive buffer: Too many errors during receive; giving up. Error during YMODEM-g receive, giving up. no control function h3600_sleeve_init_module h3600_sleeve_init_module: malloc failed h3600_sleeve_insert: no spi read, defaulting sleeve vendor h3600_sleeve_insert: no spi read, defaulting sleeve deviceid sleeve vendorid= sleeve deviceid=h3600_sleeve_insert: matched driver registering sleeve driver BackpaqSysctlGenControl=BackpaqSysctlFPGAControl=BackpaqSysctlFPGAStatus= busy: status= pbuf= pbuf=bytes_written=busy_count=sleeve detect -- detects h3600 sleevedetectsleevesleeve insert -- detects and enables h3600 sleeveinsertsleeve eject -- disables h3600 sleeveejectsleeve on -- enables OPT_ON, does not attach driveronsleeve reset -- asserts OPT_RESET for 200msresetsleeve fpga -- load fpga from dramfpgainitsleeve detect=usage: sleeve detect | insert | eject no control function dual pcmciadual_pcmcia_probe_sleeve dual_pcmcia_remove_sleeve Compaq Dual PC Card Sleevesingle cfcf_probe_sleeve cf_remove_sleeve Compaq Compact Flash Sleevesingle pcmciapcmcia_probe_sleeve probing for dual pcmcia sleeve dual_pcmcia_linkup[0]->prc=pcmcia_remove_sleeve Compaq PC Card Sleeveh3600_generic_pcmcia_init_module: registering sleeve drivers h3600_generic_pcmcia_exit_module: unregistering sleeve drivers no control function generic opspcmcia_init_module pcmcia_register_ops: ops=cis mapping=cis[0] =end manfid[0]= manfid[1]= funcid= fixed disk pcmcia detect -- detect presence of pcmcia/cf cardsdetectpcmciapcmcia cis [slotno] -- show card information services (CIS) data cispcmcia insert [slotno] -- enable and bind driver to card(s)insertpcmcia eject [slotno] -- disable card(s)ejectpcmcia detect= type= len=ide_use_packetide_use_chs identify command= ide status= serial_number: firmware_revision: model_number: n_sectors_user_addressable= bytes_per_sector= major_version= minor_version= flags= bytes_per_track= n_sectors_per_track= n_cylinders= n_heads= cmdset[0]= cmdset[1]= cmdset[2]= cmdset[3]= cmdset[4]= cmdset[5]= ACTUAL bytes_per_sector= start_cylinder= start_head= start_sector= sector_count=issuing read command ide read: status reg=ide read: error reg=ide command failed with status= error reg= cyl high reg= cyl low reg=ptable signature=did not find dos partition table signature reading partition buf=partid= n_sectors = n_bytes = reading n_sectors ide write: status reg=ide write: error reg=write partition ide identify -- reads and prints disk identification/configuration informationidentifyideide attach -- attaches ide drive at ioaddr -- not needed normallyattachide ptable -- reads and prints the dos partition tableptableide read -- reads from disk to dramreadide read_sector -- reads one sector to dramread_sectoride read_partition [nbytes] -- reads from partition to dram. partno starts at 0.read_partitionide write -- writes to disk from dramwriteide write_sector -- writes one sector from dramwrite_sectoride write_partition [nbytes] -- writes to partition from dram. partno starts at 0.write_partitionide debug -- toggle ide debug (very verbose) modedebugide verbose -- toggle ide verbose modeverboseide 8bit -- read/write sector buffer one byte at a time8bitide 16bit -- read/write sector buffer two bytes at a time16bitattaching ide drive at ioport= len=ide_debug = ide_verbose = ide_sector_buffer_stride=sectors_per_cluster=0 bytes_per_sector=0 -- bpb_info invalid Invalid long filename entry: ordinal < 0 Invalid long filename entry: filename too long vfat_read_clusters called with nbytes=0 vfat_read_clusters_offset: offset is not in this cluster: offset=vfat_read_clusters_offset: offset is not at beginning of sector: offset=Reading cluster = Reading sector = Placing at = vfat_read_clusters_offset: reached VFAT_EOC at bytes_read=Freeing cluster Destroying currently allocated chain... Not enough free space on device. Allocating cluster vfat_write_clusters_offset offset = vfat_write_clusters_offset: offset is not in this cluster: offset=vfat_write_clusters_offset: offset is not at beginning of sector: offset=Writing cluster = Writing sector = bytes_written = vfat_find_dir_entry: fname='' dirname=' basename=' searching root_dir_entries . vfat_find_dir_entry: find_file_in_dir: vfat_find_file_entry: fname=' dirname=' basename='vfat_find_file_entry: got dir entry for attr= clusterno= n_bytes= looking for file entry in root_dir_entries: vfat_find_file_entry succeeded: Could not find file. attr= first_cluster= n_bytes= vfat_list_dir_entries: attr=vfat mount: reading bpb_info oemname= sectors_per_cluster= n_reserved_sectors= n_root_entries= root_dir_sectors= first_root_dir_sector= fat_size= fat_size_bytes= n_fats= total_sectors= n_data_sectors= first_data_sector= n_clusters= fat_type=root_dir_entries: fat: first data: vfat mount [partition] -- fat partition on IDE partitionmountvfatmmalloc failed cmd vfat mount: partid=get_ide_partition_iohandle failed vfat_mount failed with rc=cmd vfat mount: listing the root directory vfat ls [dir] -- lists directory contents on mounted vfat systemlsvfat ls: rc=vfat ls: entry.n_bytes=no vfat mounted vfat next_cluster [clusterno] -- computes next clusterno from vfatnext_clusterclusterno=nextcluster=vfat read_cluster read_clustervfat read_cluster vfat debug [level] -- toggle/set debug verbositydebugvfat_debug = vfat_file_open: file not found errno=Reading in parent entries... Cannot find file. vfat read [bytes]readbytes read=vfat read [bytes] vfat write [bytes]writebytes written=vfat write_file [bytes] vfat set_filesize -- resets file sizeset_filesize is a directory. could not be found. error = Division by zero!   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~23IRRSS                    " $ % & / 5 6 7 9 : < H I !!!!! ! ! ! !!!!!!!!!!!!!!!"!$!&!(!,!-!.!/!0!1!3!4!9!S!T!U!V!W!X!Y!Z![!\!]!^!_!`!a!b!c!d!e!f!g!h!i!j!k!l!m!n!o!p!q!r!s!t!u!v!w!x!y!z!{!|!}!~!!!!!!!!""""#"6"<"d"e"j"k"""$$$$$$$$$ $ $ $ $ $$$$$$$$$$$$$$$$$$$ $!$#$$$`$a$b$c$d$e$f$g$h$i$j$k$l$m$n$o$p$q$r$s$t$u$v$w$x$y$z${$|$}$~$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$%% %%%%%$%,%4%<%%0q3r3s3t3u3v333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333)MNOPRTUVWYZ[\_`abcdefhijk  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^ %,37:>BFJNRVZ^aeimquy} !&).369<?BEHKNQUX[^adiorwz}  #&),/38<?CHNRUY^adgjnrw{ #(,16:>BFJORV[`ejoty~ "(.48<@DHLPTX]bglqv{  %*/49>CHMRW\afkpuz  #&),/258;>AFJNSW[_cgkosw{ !&+07@DHLPTX\`dhlptx| !$'*-0369<?BEHKNQTWZ]`cehknqtwz}         " % ( + . 1 4 7 : = @ C F I L O R U X [ ^ a d g j m p s v y | (C)<<-(R)u,>> 1/4 1/2 3/4 AExssaeIJij'nOEOEoeoesLJLjljNJNjnjDZDzdz'^'`_:~ -------'','"",,"+o...... ``````<>!!?!!?RsEURa/ca/sCc/oc/ugHHHhIILlNNoPQRRRTEL(TM)ZOhmZBCeeEFMoi 1/3 2/3 1/5 2/5 3/5 4/5 1/6 5/6 1/8 3/8 5/8 7/8 1/IIIIIIIVVVIVIIVIIIIXXXIXIILCDMiiiiiiivvviviiviiiixxxixiilcdm<--><-><==><=>-/\*|:~<=>=<<>><<<>>>NULSOHSTXETXEOTENQACKBELBSHTLFVTFFCRSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCFSGSRSUSSPDEL_NL(1)(2)(3)(4)(5)(6)(7)(8)(9)(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)(1)(2)(3)(4)(5)(6)(7)(8)(9)(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)1.2.3.4.5.6.7.8.9.10.11.12.13.14.15.16.17.18.19.20.(a)(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)(A)(B)(C)(D)(E)(F)(G)(H)(I)(J)(K)(L)(M)(N)(O)(P)(Q)(R)(S)(T)(U)(V)(W)(X)(Y)(Z)(a)(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)(0)-|+++++++++o hPadaAUbaroVpcpAnAuAmAkAKBMBGBcalkcalpFnFuFugmgkgHzkHzMHzGHzTHzulmldlklfmnmummmcmkmmm^2cm^2m^2km^2mm^3cm^3m^3km^3m/sm/s^2PakPaMPaGParadrad/srad/s^2psnsusmspVnVuVmVkVMVpWnWuWmWkWMWa.m.BqcccdC/kgCo.dBGyhaHPinKKKMktlmlnloglxmbmilmolPHp.m.PPMPRsrSvWbfffiflffifflst+___,.;:?!(){}#&*+-<>=\$%@!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     `     `  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   ~~~~>>xx(( 8HHHHHI,CTDCDCDCDC`,CL,C*C,CDCD!CFRH,CD,C@,C<,C8,C4,C0,C,,C(,C$,C,C,C ,C,C+C+C+C+C+C+CH,CD,C@,C<,C8,C4,C0,C,,C(,C$,C0123456789NhBàBBHB+Cd%Cì%C%C<&CÀ&C&C'C\'Cè'C'C8(CÄ(Cð(CX)C?98765432109876543210touppertolowerupperloweralphadigitxdigitspaceprintgraphblankcntrlpunctalnumCPOSIXANSI_X3.4-19680w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-1.1.3unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check     invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeat inflate 1.1.3 Copyright 1995-1998 Mark Adler  #+3;CScspp !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengthsinvalid literal/length codeinvalid distance codeinvalid distance codeinvalid literal/length codecramfsCRC Error!..4 offset cnt = node offset cnt = obsolete cnt = add_node: malloc failed UNKOWN COMPRESSION METHOD = find_inode failed for name=Scanning all of flash for your JFFS2 convenience. Est Time: 6-12 seconds! build_list: max = .Offset = add_node failed! dir entries = frag entries = +4 increments = +file_offset increments = Failed to scan jffs2 file structure Failed to find inode Failed to resolve inode file structure Failed to read inode Compr = NONE: frag count: compressed sum: uncompressed sum: Compr = ZERO: Compr = RTIME: Compr = RUBINMIPS: Compr = COPY: Compr = DYNRUBIN: Compr = ZLIB: jffs2zImage0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-HB@(HBPHBÜPCxHBàPCøHBHBHBHBHBHBHBHBCIBIBøPC,IBDIBlIBÀIBàIBôIBIBJBJB8JBIBIBXJBxJBÈJBØJBèJBøJBJBJBJBpKBøKB @KBTQCCXQCðCQCôC4LB$LB8LBDLBHLB[C QCCZCPLBXLBQC`LB\ZCMBNBNB NB,NB8NB\NBÔNBôNBNBNBNB$OB,OBTOB\QCtOB\CÈOBÌOBØOBÜOBpCäOBOBOBOBOBOBPBPBÄC`PBlPB|PB̻CÌPBØPBäPBôPBPBPBPB`ZCDZCPB QB(QB(QCøC8QBQC@CC\ChCdQBÈQB\CüCзC QCTCQBÌRBdZCäRBÜRBôRBXC,SBðSB0CøSBSBSB,TB@LTBPTBdTBxTBÌTBàTBôTBTBTBTBèC\UB|UBTZCØUBLUBUBVBÐC,VBQCQCÔC@VB`VBÀVBìVBVBWB$WBD`BlBxBÈBÐBØBàBèBðBüB̢BB\CBBÄ]C]CB8BhC`BhBtB|B|CÐ]CÈBìBÄBԤBB@BÀBøB@C8B@BTB`BpBÀBÔBئBBB$BÌBàBèBħBBCBB4BPB8BpB|BÌBèBôBȨBBBBB BHC@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~ u@Ôx@z@Ø{@{@Ì}@@ÀuBÉSCÀ|QCbootldrroot  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx| u@u@x@Ø{@{@Ì}@Ì~@ÐuBÉVCÀ TCbootldrroot  $(,048<@DHLPTX\`dhlptx|uBÉVC@VCbootldrroot@@  "$(*,.02468:<>@uBÉVC%XCbootldrroot  "$&(*,.02468:<>@>>>?@???@uBðVC'YCbootldrparams,VCàWCèXCøYCSC@ð@,@@@@@|@@ @<@@@X@@ZC$B> B,@>B>B BBB,B AATBP Ap A\BÜ AABAABԶCôCèC0   0@>D0e( @>D0   0>D]C,]CX]Cx} xTd˽;[ulǚlnMikQʽj FvlǨ!ćtL&(^VD`RRaWX0(!gȦ8}6%g>' `TͶ{Hd&r@$@9LC¡.utIm/ tT-$]Q~ ?km& B;)xr4v@D\+!!Q>u8ʬñܡNSIs8 V!"5r:\"]DZПL1Г *O ~$sk>v0.QvJ?Z13`fxQ(\h|'*˹\(^羱9Vz~MUMRjo}n>vwc΁'BtcNE7E2Os7oVw7|ws'7m*,XZ 6,W~ @H'˸*{'oY`$%|*1 ='{wY_o"_|_Tl!mZ`9Qg8?ܬĒ>nQ"Uߐl_*er.{3?X(u8缐tIK3Ea]zNYZ7wwZ蹻݊5Ófr _-c>8J'ڱ(+J 2Br }nEG&~:tQaSZL ? 9S dS,3t1S7@-=C`$]OXT p@ j"[b8~.M=b_rx˭sτO/]~Q t81cA*e) +XֹA̿J]rr'4Tu0GZ69OXS{0,A``1XØ)xPC>RY H'7 qDoFu+͸@?#Z(`ܳhz֑GX3} Eru2݉\[S? XK1=f\"HHY+,^N%Bqe_A.JDSWHF9P8Ҥ?6\@#$юNΦ8:;:a*ew_qJH"?zxU+/~{Y2o^L]+q%1eh>jU{&J»cNvMOu^򎸢 9v>y{4ɉ LGҿ.иB2^jQ~!3_y{[o b%3^X["1"Qj2ZIZӷ$E]#~l\e[Zctøe[SwKzڍ\wu^d\H[FhYd RivmwK$Y8,t5B'JT^Tڬ#~N:餓N:餓N:餓N:餓N:3^3Er{qWK=Kw-^\+Qꔞ/۴aӆ;Wo0۹s=߮V֩5_ZZtꔂp6g[P:g]^K}=KYkޤmÝ{xz4tXސ}Ӿ_v۴o㵆5o.-:S9}75l_{}tsV?;/ɇW7g)S]M;RIJIn#LۛgE)ߴ˱mUMUmYvSᆝK{pڗ1ZcG<ِ{n w3+nhR>SEbvC'b*_qkpFD8?z6tR@~[UGYKW-wX[+n0TvuK:6RsW6-YxElk G[lڷ:Ĝ_o?H@_&lՆ7R/:~ԑե?ڑ߶U!0*i>b>gbu~TsVWkGc0KWXyg&04zޕgL;3Qx |弊^Hw^yr/|bYwv>˱֎^{觢RC٬Gl.Is4|g&/Y )N?:iI_![58FZ/28M7֜>ajq?,teťE=?az+(%UH?|$odMa2XԨ2zYUou@R9`U=aw.5euoHC"qŬX?3Ht/dǂlXգS\kԚM*_jRp811.ʭ](z$RnŅ]XR޹c^&Hl/X%13㊙py&DQÇS1KcX46YmJD^;K^kߩ4j|2-wbS:UbPت_謏_zxh㋹*TLf&U6/~nEQ:Ƕm[֮Q폮 [X[^V7|,։CdoeaHǗ[$ˤSYGKY]m3p8 lr$':OVnXջw(w4{y vW8*ݮL-2$LߚZG%b>ݫ }{]C %]뽆SNvi^q.c&vd瘝QJ-gd k "/Ď[Th;wҟ |`]}dGQW8oSmy[áQ qѠr@tx&جkwlV,"!cHpS=Uߦ e0NbW1?8ߚgujߤګ:Z;0sȔgۂЯ2r$t VH&2钊WOt(["CqVCQOc-mu; ]#sĐ[Lޅ[3WGj]}wnZ5K}끬cۉ.w{뾬._]+I-mAɞhVtY}g\9=˂Vb쫟ZitYYU[*4G[{qP dmyiowŧ;^yM򀎿I@"sҟԑMZ{TWZɴ#*Hy7Mm2,]M? sr ڪ'>e5^m/>jm4<*C#WmJ8 f7O$<2S<:,  dͲZ, c2X:ڧ je0Bs&oO^1}CߴƋG/br 4Wm-\4[/YphUd:]mFhhr \ LNyE#(˵d'Β7NN4}Mw@[ P ,AVUqO܁h{O}\[UDd2enlh.%ojs]ko&sbxM/yX_e$yȩuL NNFw8cn)W"S=k<R.5yQ|'Gpb%3%UЊJS9߸(22Z$ yv넵8zKle2ھ>=a=aHv?yXGbI!?4PEК<DXJć ʨ-CGpV[I_yoUzH7V]bܵ6VTkoHCȶ`]I]>k6%ݦ+/!@diJ`2.J!L 8'X!!,K۫6ͶS+Tgc 1@ƀlܐF@/g$ExO%x7zKD?ipv:؟54e?|go݊jܲe#ЎiG8JkQjw8ỏn.ԕe$Kv?r9;|wWnI {3;V|t77 3/G.ʆ@v8;> *>s^n#ᏸot7 &(=V9өߛݦ22+n˾ Oy.^osFAƠ`zx`t J_M:3W9>ry GV?@s -@>ߠʵ8=?!pZ倯{-75ް!w?cw-1[m:=myLN\ߵi[ڤe~X񗝰Ri[P_׎6m% NFלOl)x|MNx4 7>V-H_"l俭lp>zcǞ/7#ߖb^-μ\Zɉ¡I3Qɉ#i f-*PO )y3 ٯMA/t5"?f iz+ 515|~K; -.4 /`e$ц Op%wY<s8]:zUW1]/䬵aKxX0Ǐ/x&/` 8-g[R :$GṴecɨmm =f^T5"?zG3'D_x~4%[s/5|fӍ7mv8:D޵]i]I!ǟQy6{ODr'FfW,Z"0N>=-FV4'hJ]"L ȗb".cFYI5l}d] O٬Z :6oQ5 \5\.)K 1eLGg7 D%`& 7F-4mhV+ψs K^U-o^aU;Gs:jdc#}ZKlLNel'x@BuV4b+ >OV/ٿ^!Sb/s6@3۳#:<"Blm[ޓUȣU._h3m<2` /Q~oƀA2LꈈLS?9tM.SM3]C*#+;:Yy;*Ú%\?ol(~o5d@W̯7(| 6W (G6LC#_ 6ܻ!~%>vӓ- ]W d$ݸ o<G?\ɦJQYjVq |5$""GOliECY~nɾo}pҰzNё`Q6&9䫌KQxoTua WwطBKL}'9 [_ (wA8; -_88Zai_ ;_GѾo>v>wTTZ23#u؜|1/Bcj=7Nl+NeU$y?aa(H2ͷ"Z÷ ѻ㱹+c`c7 ҍ}!}@1 V륧J*mA%gNP;+<ǖ族[YOh,ɳ?a[Y:z{w>"D4,˭*gT9P \_D\Wn6hy١U𳑩=<#~O7_pV<~_ i֩W#s62;9wH?I*[]r('J&iVPRMO]g1iKI!oJؘjf^#Ao>.׊mG $ɏD9߭Nc.Rˉ9iRz!Z?ai(TjʯҤjA(LrE=i *¨~g.2D.Je*=} G`ש@Y\偽i21Jg|Dqv$/@,Ww*aҶ9ȿN]5T9GyH,#GTQxj~4;sFqnbUD4nPT~[fvGut s=ڳGW:!/PSv T=t*b&Z]?!/u@̶mS9_lf%; :c CES><ao[pyfojn})z_,u*ؽX:?OZɣiރjɛU! 48YtBB{qFvGm}K }z1N~$Hco&cP.B;S@;HuHNTFIߣ८KD1k^o~myܬ0-ؼ3X}Ƴ/ 9{ǡN7?lJ!-KE:R߈ mnKn Ώ= ΀9U >C<,;nW[OTjU[FCޛchT>a9vN7 jX ߎB͏o,űh' ԇ/4?o,iVl!|yK7zw&&_|H_F86=o/yα!WwzmUZ#3 T ߻>X`Os`뺡+oԠb{_kλ1i})/G8.ұG U7uvtw,(ox(Nl/'9_FE4{E~ʞRK_cnn ޣr;([r;@wm= u3 ŷ~+ ͒>[dAP%_dkp::r{epO>>.6- @np w5[cWswwty$4q䙜K]{m9CcqE~"v;U={ ̮[2ˎyޟwkj#X_E}7jjs^ 9g*]tM'({@y[T\RQC[rhZ4s1S5Ϩ=:(˶/ߞ=rW7_{{ONu1>Ter,Zqˬb[rnԱ@뾬WVl:z,ǫL)KS<'AX_"pN=%"}Š#{r0Xb69Þgb|O Ğ;2.^xB-{/䥛g8~Wg._ nվ~j>?#xn_V#_ʄh6Mwg/iql٦sr-4u_o`YM5BCQGn~_ |s8rK,$X+bwq#U9x\~~1[·ܪp{p?i(m_x_o<ˊ@Qa{s̉ѯ׃_Jeenܧ|vOzpŋ>>nK$⢱r ێۻ4kj姿TWݿbn|URSG9֩_(S! /+i2|&qΣFkEr/4q ^-T ei?ks+T|}Η d<}2G_RHL]6֠ /ޓ/ߊ 'SIC[~u9Vu|맿T_=-@_oSomۏL%}琪 R-Js_{S0TJݓ'$wh[DuAOOA׃BpKxUQ[/K+#EvޫgTy0/]͗|7?ke| T7{SߓuCЄ%_ɯ/n[x,WU*TRП_S/fԑuiuS?vE}e'=7xްD9%'s4|Qŋ#JM/x* QBz|-Sy4A-S{cE~h NKs$[ ㊥䯛S yxSD}jƏs&.Rs_m?.p>oJV1Cnh_2?z |cWt8O<{ o} (?Q>AHAx$ 唊$yԯSed^۽B|Qm{.(-+\o 6H9~I ~+_n>S1՜l_5] 9 qCϘ_]C܏oknG`ed]ě{ .YQީ~BV˖qKop﹨s^Kz윟0~ް2Q}Oܗ-{|jg[S/V[0B#\yCՠNޖ)N' Yhz_iӧmWaq?/¶v7mJ V,1VseTܿ,~9'117;;?QDt\{kd_sB aszgnO|[ԇ^}F\A[<1?.y,Nn 3WG.6Bk{4o $:G)}i;Hv.Ň_ay/6ا4׾-5G/[r_sKW?AU#A̬ ZveޝZ'%m19foEdmJw(|6w\`ɭaXOguz̟˞Md3Š3{̰l㇭?|bo "+c3!yBQ&VIн/"K=>7mrq)+S{/8oẅ%yՃCRakcsJ%g)Y=fZ(7g*crx-}'1o`eUn\I2t?gd|^(ZX`~EX܉^;1\wY䄾%5FL%.'E-`mSJ+97o]7ojb"3(\Vޭ75l-ua 2LJRKj`{:(!!{̑ nQpY@N_Їڿ$ѧ;BtDC,\H*h%BW%? 5gb"gb{2l_"Fv!fs97/}WKxGM%D ! *Xx}"B&|CeRǿmsڇߏҩ"eqn' _8*}[/R6G=!qT<1Qumu>󿟵}+MOsc~Cceʉaʿ̺e)ӼXˑ,Kwӯ3 iR3)Jʵ \JIQoHO?>QOtfeT(Ej(3*J o/-AyQH7Z =Ήn 6x'rsOE ,b`7K٠d U?DL{w+v iIL"TݝnB@EeNǸ"dīn ߙfO 7l}OMWsrL rb;WV\?Ra,X\yQ&b鍠_Pnk<߸"SoƷsX"2M awlA,Q.']@gcvQ*hu]~c3_o؈Jv:[|¤y$g=xAx_Qwȋ9Ge ;-ƛ>#ͣ?vVZ|SW.e0f%͊_eWkQ7}n79+tw zV^wiR_ya]NWr%o`MWrSc7tzsnvm|Ux1;bd4bnhvM~ lI؉脵d1ףg hu&i>aMWe\l724/4>NvuI}cȢIM^:M<:=:]l%li)82~NW ,yQ [: Eig[녢v:tD^ ĒBiޓvQ⡒9#r'7%d%u ErGk,uM}sINlf5l1 =Hs[l]HW$2ra@L?Ƒe+M2oJBOydwqw=7g#8:-hĬl;R(r ۣ&`:}Zȥ 7VkWdeD|ulZ/D+ uK&jFQa?RaCrUɽP4Z6M5ѥ.l۞##ƵF\ ?a`cEnc*LNz?_ǜ:Uo9Z}q%SkOh/*r5\6H_ABYp"[BDB4,h}fWb X&D'j/|jE$"j>Sg2rX~2}uGŸ\msXn8I+yiLjI8aȄ +fEj9<D}&Da=n,0bphG6t |'@!sqP=;e Ly-2Ri\Lr4 SCR1X%"_gmn箵 T^ɛ9(-S^Y+~&L & k&+]eB8l Mo$oF'j~;UbTVho<#۟(w ns5ZVHP9 %?/Yv&%)] >Ccv"zdc![G7x "E9Ua8>X\VD OAz(\V aTqD=dhX|N\Ց:Hw$r`*QT"sϛ|t&fYHN}eDh$M|ڕS?ynb31Ve%uo$KR=}ެ2gi+eÒSagX#7Ro"?.+V_ A1 =bMh9l FWzp'HbT2yZHLy 䯈<7gܬM9ʉ:ٚ0<z޵ԅb9>,a&h-;O% euhJaɣY~ vj }E~1tDr!yudPb}'_W9~~,xOoyDI4GIxfۡ ۀBi\7YcscGH'K,KA䕭pDV2[l%bd{ Ͷ.Zݵbdye%\S\a4nPrW^p>y〮Sg?yeԣ'c_$u]QX00jBk#͉KKjƒXC rHQ?ԇhn$ X`M'a XFdk{5As>/pX;uZQH䇲4Zk3wtJO7e*'4ytXCvch {{&dٚ.I`0@BR )xwlZLVeOkI~s@w$S|L? 0q6HqCS,vێr-|_NHdzwxP!S왬X,ZVv܅+N9 Rk;G^ZMƟ$Ц<$%N{6;!IDDJIR176y&;6kGV+]<rQ?hnd3_^13FNɉ֎c|B O=ݱ9-$>Ijݟ'FB-cF1|8q]IKIֻ{@c#HUGǶc@ǡ fZδOq nP%*kwYE~9g(L^Gk|$Lq.#P-#Y )FJXx-9dmЛD[$i<='/Lvl=e~#w&?kiݟFkso(D}}!,P;30lwR=4,㏼5[zZKaL\t{l$?z'f&k>e)p'"@ 6'_|c7qߎ͙=;#_yݟǃIi$q֢K0e;LFaa/)n|Mn&bibj|176,iIKe/sTo:%zشYҶ5~ң=64=hQngAl9_il.֓$pHBcJ$y3"<̢KLCBN:餓N:餓N:餓N:餓NӍ?i%A$WA$WATWABkAlA%аBäCXlAlAB% BC`mAmA Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??pBèBt5CB8B,8C      EB@`BaB?@ÐaB bB@@aBcBB@PcBdB`D@ÈdBdB`D@ðdBeBAȧBB,B XAÀBB@B XAøBBBtiABBLBtiABB|BtiATBBøBtiAÄBBBtiAüBB(BtiABlBdBàvA$BlBøBvAtBlBBìxAüBlB0BxAB BBTAķB BpBhA$B BðBAxB BBôAøB BHBDAB BüBÌATB BB A̹B BdB|AB BܺBČAtB B BXAB BPBÜA(B BÐBAXB BԻB AØB@B8BشAB@B(BܵAB@BìBAhB@B BAB@BÄBȸAPB@B BlAB@BÈB4A`B@B BAB